United Kingdom (UK)
Recombinant monoclonal antibody to ZP2. Manufactured using AbAb’s Recombinant Platform with variable regions (i.e. specificity) from the hybridoma IE3.
UniProt Accession Number of Target Protein: P20239
Alternative Name(s) of Target: Zona pellucida sperm-binding protein 2; Zona pellucida glycoprotein 2; ZP-2; Zp2; Zp-2; Zona pellucida protein A
Immunogen: Osbourne-Mendel rats were immunised with solubilised zonae pellucidae from DBA/2 mice. Splenocytes were obtained from immunised rats and fused with the SP2/2 murine myeloma cell line to generate hybridomas.
Specificity: IE3 reacts specifically with ZP2 (East & Dean, 1984), where the specific epitope (TIKVVGGYQVNIRVGDTTTDVRYKDDMYHFFC) is at the N-terminus. ZP2 is a glycoprotein which forms the zona pellucida, an extracellular matrix surrounding mammalian oocytes. These glycoproteins act as receptors for sperm and this recognition serves as a critical step of fertilisation.
Application Notes: IE3 was shown to react with ZP2 by immunoprecipitation and immunofluorescence staining of various mouse tissue sections (East & Dean, 1984; Avella et al, 2014). IE3 was also shown to neutralise ZP2 activity in vivo by causing transient infertility in female mice.
Antibody first published in:
East & Dean. Monoclonal antibodies as probes of the distribution of ZP-2, the major sulfated glycoprotein of the murine zona pellucida. J Cell Biol. 1984 Mar;98(3):795-800. PMID:6699085
Note on publication:
Describes the generation of five mAbs directed against the mouse zona pellucida, and the use of these mAbs in characterisation of the zona pellucida extracellular matrix.