- {{heading}}
- Ab04113-1.1 Anti-OPG [AbAb01OPG]
- Human
- Mouse IgG1
- Purified
- Ships in 5-6 weeks
- Ab04113-23.0 Anti-OPG [AbAb01OPG]
- Human
- Rabbit IgG
- Purified
- Ships in 5-6 weeks
Recombinant monoclonal antibody to OPG. Manufactured using AbAb’s Recombinant Platform with variable regions (i.e. specificity) from the hybridoma AbAb01OPG.
UniProt Accession Number of Target Protein: O00300
Alternative Name(s) of Target: Osteoprotegerin; OCIF; PDB5; TR1; TNFRSF11B; Tumor necrosis factor receptor superfamily member 11b; TNF receptor superfamily member 11b; Osteoclastogenesis inhibitory factor
Immunogen: The original antibody was generated by immunizing Balb/c mice with a KLH- (Keyhole Limpet Hemocyanin) coupled synthesized OPG N-terminal epitope (MNNLLCCALVFLDISIKWTTQETFPPKYLHYDEETSHQ).
Specificity: This antibody is specific for the N-terminal epitope of OPG.
Application Notes: This antibody was generated as a capture antibody that binds to the N-terminal epitope of OPG, as verified by an ELISA. This antibody and the corresponding detection antibody (AbAb02OPG) were used to create an OPG detection kit, which demonstrated a good correlation with a control OPG kit in detecting OPG concentrations in serum samples (CN113621060A).
Antibody first published in: PMID: