United Kingdom (UK)
Recombinant monoclonal antibody to Strep-Tag II. Manufactured using AbAb’s Recombinant Platform with variable regions (i.e. specificity) from the hybridoma C23.21.
UniProt Accession Number of Target Protein: P22629
Alternative Name(s) of Target: Streptavidin; 'WSHPQFEK'; strep-tag
Immunogen: The original antibody was generated by immunizing BALB/c mice with recombinant ectodomain of glycoprotein E2 of GB virus, containing a double Strep-Tag of amino acid sequence 'AGWSHPQFEKGGGSGGGSGGGSWSHPQFEK'.
Specificity: This antibody recognizes an antigen with amino acid sequence 'WSHPQFEK' present in the Strep Tag with a dissociation constant of 1.4x10^-10M. It recognizes another fusion protein namely VHH-E9 containing the strep-tag sequence of 'LESAWSHPQFEK' at the C terminus with a dissociation constant of 9.1x10^-10M.
Application Notes: This high affinity antibody can detect the strep-tag II fusion proteins in ELISA and western blot assay. This antibody is recommended for strep-tag recognition in fusion proteins through western blotting or immunohistochemistry methods, or to immobilize strep-tagged fusion proteins on Biacore sensor chips for performing Surface Plasmon Resonance (SPR)-mediated protein interaction studies. It can also be used for the purification of strep-tagged recombinant proteins using an affinity column or immunoprecipitation meothod.
Antibody first published in: PMID: