United Kingdom (UK)
Recombinant monoclonal antibody to SUR2B. Manufactured using AbAb’s Recombinant Platform with variable regions (i.e. specificity) from the hybridoma N323B/20.
UniProt Accession Number of Target Protein: Q63563
Alternative Name(s) of Target: N323B/20R; ATP-binding cassette sub-family C member 9; Abcc9; Sulfonylurea receptor 2
Immunogen: This antibody was raised by immunising BALB/c mice with a fusion protein amino acids 1503-1545 (VHTILTADLVIVMKRGNILEYDTPESLLAQEDGVFASFVRA DM, cytoplasmic C-terminus) of rat SUR2B.
Specificity: This antibody is specific for the SUR2B protein and does not cross react with SUR1. SUR2B is a subunit of ATP-sensitive potassium channels (KATP). Can form cardiac and smooth muscle-type KATP channels with KCNJ11. KCNJ11 forms the channel pore while ABCC9 is required for activation and regulation.
Application Notes: This antibody is recommended for detection and analysis of SUR2B by immunocytochemistry, immunohistochemistry and western blot.
Antibody first published in:
Andrews et al. A toolbox of IgG subclass-switched recombinant monoclonal antibodies for enhanced multiplex immunolabeling of brain eLife. 2019; 8: e43322. PMID:30667360
Note on publication:
This article describes the generation of a library of recombinant monoclonal antibodies (R-mAbs) from a pool of mAb-producing hybridomas for neuroscience research.