Multi-Tag Control Proteins

Absolute Antibody’s Multi-Tag control protein (Pr00106) and Multi-Tag control protein 2 (Pr00565) are genetically engineered synthetic fusion proteins composed of commonly used epitope tags fused together using flexible linkers (Figure 1 and 2). These Multi-Tag synthetic fusion proteins can be used as a positive control in western/dot blots and ELISAs.

You can also check out our epitope tags page for our full range of recombinant and chimeric anti-epitope tag monoclonal antibodies. For further information on our Multi-Tag control proteins or any of our products, contact us and we will be happy to help.

Figure 1: A schematic representation of the Absolute Antibody’s Multi-Tag control protein (Pr00106), composed of 17 commonly used epitope tags shown in sequence from N- to C-terminal.

Figure 2: A schematic representation of the Absolute Antibody’s Multi-Tag control protein 2 (Pr00565), composed of 12 commonly used epitope tags shown in sequence from N- to C-terminal.

 

Table 1: List of tags found in Pr00106 and Pr00565.

Multi-Tag control protein (Pr00106) Multi-Tag control protein 2 (Pr00565)
Thioredoxin (Trx) tag

 

SDKIIHLTDDSFDTDVLKADGAILVDF

WAEWCGPCKMIAPILDEIADEYQGK

LTVAKLNIDQNPGTAPKYGIRGIPTLLL

FKNGEVAATKVGALSKGQLKEFLDAN

LA

MBP tag MKIEEGKLVIWINGDKGYNGLAEVGKKFE

KDTGIKVTVEHPDKLEEKFPQVAATGDGP

DIIFWAHDRFGGYAQSGLLAEITPDKAFQ

DKLYPFTWDAVRYNGKLIAYPIAVEALSLI

YNKDLLPNPPKTWEEIPALDKELKAKGKS

ALMFNLQEPYFTWPLIAADGGYAFKYEN

GKYDIKDVGVDNAGAKAGLTFLVDLIKNK

HMNADTDYSIAEAAFNKGETAMTINGP

WAWSNIDTSKVNYGVTVLPTFKGQPSKP

FVGVLSAGINAASPNKELAKEFLENYLLTD

EGLEAVNKDKPLGAVALKSYEEELAKDPRI

AATMENAQKGEIMPNIPQMSAFWYAVR

TAVINAASGRQTVDEALKDAQTNSSSNN

NNNNNNNNLGIEGR

T7 tag CMASMTGGQQMG GCN4 tag HLENEVARLKK
HSV tag QPELAPEDPEDC MAP-tag GDGMVPPGIEDKIT
VSV-g tag YTDIEMNRLGKG Protein C tag EDQVDPRLIDGK
Glu-Glu tag CEEEEYMPME Rap-tag GDDMVNPGLEDRIEC
V5-tag GKPIPNPLLGLDST Rho-tag TETSQVAPA
E-tag GAPVPYPDPLEPR Alpha-tag SRLEEELRRRLTE
HA tag YPYDVPDYAC Rim-tag PLHPRTAGASR
FLAG tag DYKDDDDK Softag SLAELLNAGLGGS
GST tag

 

PILGYWKIKGLVQPTRLLLEYLEEKYEE

HLYERDEGDKWRNKKFELGLEFPNLP

YYIDGDVKLTQSMAIIRYIADKHNML

GGCPKERAEISMLEGAVLDIRYGVSRI

AYSKDFETLKVDFLSKLPEMLKMFED

RLCHKTYLNGDHVTHPDFMLYDALD

VVLYMDPMCLDAFPKLVCFKKRIEAI

PQIDKYLKSSKYIAWPLQGWQATFG

GGDHPPKSDLV

Strep tag WSHPQFEK
Myc tag EQKLISEEDLC His tag HHHHHH
S-tag KETAAAKFERQHMDS Pep tag AVERYLKDQQLLGIW
KT3 tag KPPTPPPEPET
E2-tag GVSSTSSDFRDR
AU1 tag DTYRYI
AU5 tag TDFYLK
His tag HHHHHH
Catalog NumberProduct NameIntro PriceAvailabilityProduct Page
Pr00106Multi-Tag Control Protein0.2mg for £175 / €195 / $230In stock,
contact us
View Datasheet
Pr00565Multi-Tag Control Protein 20.2mg for £175 / €195 / $230In stock,
contact us
View Datasheet