United Kingdom (UK)
Recombinant monoclonal antibody to SVOP. Manufactured using AbAb’s Recombinant Platform with variable regions (i.e. specificity) from the hybridoma N356/23.
UniProt Accession Number of Target Protein: Q9Z2I7
Alternative Name(s) of Target: N356/23R; Synaptic vesicle 2-related protein; SV2-related protein
Immunogen: This antibody was raised by immunising BALB/c mice with SVOP epitope: amino acids 1-85 (MEEDLFQLRQLPVVKFRRTGESARSEDDAASGEHDVQIEGVRVGLEAVELDDGAAVPKEFANPTDDTFMVEDAVEAIGFGRFQWK, cytoplasmic N-terminus) of rat SVOP
Specificity: This antibody is specific for SVOP epitope: amino acids 1-85. The antibody does not cross-react with SVOPL/SVOP2. SVOP has transmembrane transporter activity.
Application Notes: This antibody is recommended for detection and analysis of SVOP by western blot and immunocytochemistry. For instance, the mouse version of this antibody was used to detect SVOP by western blot in adult rat brain membranes and membranes from SVOP knockout and wild-type mice.
Antibody first published in:
Andrews et al. A toolbox of IgG subclass-switched recombinant monoclonal antibodies for enhanced multiplex immunolabeling of brain eLife. 2019; 8: e43322. PMID:30667360
Note on publication:
This article describes the generation of a library of recombinant monoclonal antibodies (R-mAbs) from a pool of mAb-producing hybridomas for neuroscience research.