Anti-Envelopment polyprotein [RV-Gn3]

Description:

Recombinant monoclonal antibody to Envelopment polyprotein. Manufactured using AbAb’s Recombinant Platform with variable regions (i.e. specificity) from the hybridoma RV-Gn3.

Clone Name:

RV-Gn3

Published Application(s):

crystallography, neutralization, ELISA

Published Species Reactivity:

Rift Valley fever virus

Product based on this clone:

{{heading}}

Please Select

Ab04482-23.0 Anti-Envelopment polyprotein [RV-Gn3]
Rift Valley fever virus
Rabbit IgG
-
Ships in 5-6 weeks

UniProt Accession Number of Target Protein: A2T080

Alternative Name(s) of Target: GP; Gn; Glycoprotein N; M polyprotein
Immunogen: The original antibody was raised by immunizing a rabbit with the full-length RVFV Gn ectodomain.

Specificity: This antibody is specific for the sequence SQCPKIGGHGSKKCTGDAAFCSAYECTAQYAN of glycoprotein N from Rift valley fever virus.

Application Notes: The original antibody was used for an ELISA on glycoprotein N from Rift valley fever virus. This antibody has also shown the ability to neutralize Rift valley fever virus in a plaque reduction assay. The structure of the original antibody was determined using x-ray crystallography (Allen et al., 2018; PMID:30590046).

Antibody first published in: Allen et al. A Protective Monoclonal Antibody Targets a Site of Vulnerability on the Surface of Rift Valley Fever Virus Cell Rep. 2018 Dec 26;25(13):3750-3758.e4. PMID:30590046
Note on publication: The original paper raised a class of neutralizing monoclonal antibodies against RVFV Gn, which exhibited protective efficacy in a mouse infection model.

Privacy Overview

This website uses cookies to improve your experience while you navigate through the website. Out of these, the cookies that are categorized as necessary are stored on your browser as they are essential for the working of basic functionalities of the website. We also use third-party cookies that help us analyze and understand how you use this website. These cookies will be stored in your browser only with your consent. You also have the option to opt-out of these cookies. But opting out of some of these cookies may affect your browsing experience.

Necessary

Always Enabled

Necessary cookies are absolutely essential for the website to function properly. These cookies ensure basic functionalities and security features of the website, anonymously.

Cookie	Duration	Description
ASP.NET_SessionId	session	Issued by Microsoft's ASP.NET Application, this cookie stores session data during a user's website visit.
cookielawinfo-checkbox-advertisement	1 year	Set by the GDPR Cookie Consent plugin, this cookie is used to record the user consent for the cookies in the "Advertisement" category .
cookielawinfo-checkbox-analytics	11 months	This cookie is set by GDPR Cookie Consent plugin. The cookie is used to store the user consent for the cookies in the category "Analytics".
cookielawinfo-checkbox-functional	11 months	The cookie is set by GDPR cookie consent to record the user consent for the cookies in the category "Functional".
cookielawinfo-checkbox-necessary	11 months	This cookie is set by GDPR Cookie Consent plugin. The cookies is used to store the user consent for the cookies in the category "Necessary".
cookielawinfo-checkbox-others	11 months	This cookie is set by GDPR Cookie Consent plugin. The cookie is used to store the user consent for the cookies in the category "Other.
cookielawinfo-checkbox-performance	11 months	This cookie is set by GDPR Cookie Consent plugin. The cookie is used to store the user consent for the cookies in the category "Performance".
viewed_cookie_policy	11 months	The cookie is set by the GDPR Cookie Consent plugin and is used to store whether or not user has consented to the use of cookies. It does not store any personal data.

Analytics

Analytical cookies are used to understand how visitors interact with the website. These cookies help provide information on metrics the number of visitors, bounce rate, traffic source, etc.

Cookie	Duration	Description
_dc_gtm_UA-49047364-1	1 minute	No description
_ga	2 years	The _ga cookie, installed by Google Analytics, calculates visitor, session and campaign data and also keeps track of site usage for the site's analytics report. The cookie stores information anonymously and assigns a randomly generated number to recognize unique visitors.
_gcl_au	3 months	Provided by Google Tag Manager to experiment advertisement efficiency of websites using their services.
_gid	1 day	Installed by Google Analytics, _gid cookie stores information on how visitors use a website, while also creating an analytics report of the website's performance. Some of the data that are collected include the number of visitors, their source, and the pages they visit anonymously.
ai_session	30 minutes	This is a unique anonymous session identifier cookie set by Microsoft Application Insights software to gather statistical usage and telemetry data for apps built on the Azure cloud platform.
ai_user	1 year	A unique user identifier cookie, set by Microsoft Application Insights software, that enables counting of the number of users accessing the application over time.

Advertisement cookies are used to provide visitors with relevant ads and marketing campaigns. These cookies track visitors across websites and collect information to provide customized ads.

Cookie	Duration	Description
_uetsid	1 day	Bing Ads sets this cookie to engage with a user that has previously visited the website.
_uetvid	1 year 24 days	Bing Ads sets this cookie to engage with a user that has previously visited the website.
MUID	1 year 24 days	Bing sets this cookie to recognize unique web browsers visiting Microsoft sites. This cookie is used for advertising, site analytics, and other operations.
test_cookie	15 minutes	The test_cookie is set by doubleclick.net and is used to determine if the user's browser supports cookies.